Mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code Genetic code in mitochondria of various organisms and in mycoplasma/spiroplasma
The mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code (translation table 4 ) is the genetic code used by various organisms, in some cases with slight variations, notably the use of UGA as a tryptophan codon rather than a stop codon .
The code
AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = --MM---------------M------------MMMM---------------M------------
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V).
Differences from the standard code
DNA codons
RNA codons
This code (4)
Standard code (1)
TGA
UGA
Trp (W)
STOP = Ter (*)
Alternative initiation codons
Trypanosoma : UUA, UUG, CUG ;
Leishmania : AUU, AUA ;
Tetrahymena : AUU, AUA, AUG ;
Paramecium : AUU, AUA, AUG, AUC, GUG, GUA(?).
(Pritchard et al. , 1990)
Systematic range
Bacteria: The code is used in Entomoplasmatales and Mycoplasmatales (Bove et al. 1989). The situation in the Acholeplasmatales is unclear. Based on a study of ribosomal protein genes, it had been concluded that UGA does not code for tryptophan in plant-pathogenic mycoplasma-like organisms (MLO) and the Acholeplasmataceae (Lim and Sears, 1992) and there seems to be only a single tRNA-CCA for tryptophan in Acholeplasma laidlawii (Tanaka et al. 1989). In contrast, in a study of codon usage in Phytoplasmas , it was found that 30 out of 78 open reading frames analysed translated better with this code (UGA for tryptophan) than with the bacterial, archaeal and plant plastid code while the remainder showed no differences between the two codes (Melamed et al. 2003). In addition, the coding reassignment of UGA Stop → Trp can be found in an alpha-proteobacterial symbiont of cicadas : Candidatus Hodgkinia cicadicola (McCutcheon et al. 2009). Mycoplasma pneumoniae also uses the codon UGA to code for tryptophan rather than using it as a stop codon.[ 1]
Fungi: Emericella nidulans , Neurospora crassa , Podospora anserina , Acremonium (Fox, 1987), Candida parapsilosis (Guelin et al. , 1991), Trichophyton rubrum (de Bievre and Dujon, 1992), Dekkera /Brettanomyces , Eeniella (Hoeben et al. , 1993), and probably Ascobolus immersus , Aspergillus amstelodami , Claviceps purpurea and Cochliobolus heterostrophus .
Protists: the red algae of Gigartinales (Boyen et al. 1994), the protozoa Trypanosoma brucei , Leishmania tarentolae , Paramecium tetraurelia , Tetrahymena pyriformis and probably Plasmodium gallinaceum (Aldritt et al. , 1989), and the stramenopile Cafileria marina .[ 2]
Metazoa: Coelenterata (Ctenophora and Cnidaria ).
Other: this code is also used for the kinetoplast DNA (maxicircles , minicircles ). Kinetoplasts are modified mitochondria (or their parts).
See also
References
This article incorporates text from the United States National Library of Medicine , which is in the public domain .
[ 3]
^ Ken B. Waites and Deborah F. Talkington (2004). "Mycoplasma pneumoniae and Its Role as a Human Pathogen" . Clin. Microbiol. Rev . 17 (4): 697– 728. doi :10.1128/CMR.17.4.697-728.2004 . PMC 523564 . PMID 15489344 .
^ Jirsová D, Füssy Z, Richtová J, Gruber A, Oborník M (2019). "Morphology, Ultrastructure, and Mitochondrial Genome of the Marine Non-Photosynthetic Bicosoecid Cafileria marina Gen. et sp. nov" . Microorganisms . 7 (8): 240. doi :10.3390/microorganisms7080240 . PMC 6723347 . PMID 31387253 .
^ Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes" . Taxonomy browser . National Center for Biotechnology Information (NCBI), US National Library of Medicine. Retrieved 30 April 2015 .