Kortikotropin-oslobađajući hormon

Kortikotropin-oslobađajući hormon
Kortikotropin-oslobađajući hormon
	PDB prikaz baziran na 1go9.
Dostupne strukture
	1go9, 1goe
Identifikatori
Simboli	CRH; CRF
Vanjski ID	OMIM: 122560 MGI: 88496 HomoloGene: 599 GeneCards: CRH Gene
Ontologija gena
Molekularna funkcija	• aktivnost neuropeptidnog hormona;
Celularna komponenta	• ekstracelularni region; • rastvorna frakcija;
Biološki proces	• imunski respons; • prenos signal; • sinaptička transmisija; • trudnoća; • porođaj; • učenje i/ili memorija;
Pregled RNK izražavanja
	podaci
Ortolozi
Vrsta	Čovek
Entrez	1392
Ensembl	ENSG00000147571
UniProt	P06850
RefSeq (mRNA)	NM_000756
RefSeq (protein)	NP_000747
Lokacija (UCSC)	Chr 8:; 67.25 - 67.25 Mb
PubMed pretraga	[1]

Kortikotropin-oslobađajući hormon (CRH, originalno nazvan kortikotropin-oslobađajući faktor, CRF, takođe poznat kao kortikoliberin), je polipeptidni hormon i neurotransmiter koji učestvuje u odgovoru organizma na stres. On pripada familiji kortikotropin-oslobađajućih faktora.

Njegova glavna funkcija je stimulacija hipofizne sinteze adrenokortikotropnog hormona.

Kortikotropin-oslobađajuči hormon je 41-aminokiselina dug peptid izveden iz 191-aminokiselinskog preprohormona. CRH izlučuje paraventrikularni nukleus (PVN) hipotalamusa u odgovoru na stres. Primetno umanjenje CRH koncentracije je bilo primećeno kod obolelih od Alchajmerove bolesti. Osim što se proizvodi u hipotalamusu, CRH je takođe sintetisan u perifernim tkivima, poput T limfocita, i visoko je izražen u posteljici. U posteljici je CRH služi kao indikator koji određuje dužinu gestacije i vreme porođaja. Brzo povišenje CRH nivoa u cirkulaciji se javlja na početku porođaja.^[1]

Struktura

CRH su otkrili Vale et al. kod ovaca 1981.^[2] Njegova sekvenca je:

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

Peptidi pacova i čoveka su identični i razlikuju se od ovčije sekvence za samo 7 aminokiselina.^[3]

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Interakcije

Za kortikotropin-oslobađajući hormon je pokazano da interaguje sa kortikotropin-oslobađajućim hormonskim receptorom 1.^[4]^[5]

Vidi još

Reference

^ „Entrez Gene: CRH corticotropin releasing hormone”.
^ Vale W, Spiess J, Rivier C, Rivier J (1981). „Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin”. Science (journal). 213 (4514): 1394—7. PMID 6267699. doi:10.1126/science.6267699.
^ Chrousos GP, Schuermeyer TH, Doppman J, Oldfield EH, Schulte HM, Gold PW, Loriaux DL (1985). „NIH conference. Clinical applications of corticotropin-releasing factor.”. Annals of internal medicine. 102 (3): 344—358. PMID 2982307.
^ Grammatopoulos, D K; Dai Y; et al. (1999). „A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes”. Mol. Endocrinol. UNITED STATES. 13 (12): 2189—202. ISSN 0888-8809. PMID 10598591. doi:10.1210/me.13.12.2189.
^ Gottowik, J; Goetschy V; et al. (1997). „Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H]-urocortin”. Neuropharmacology. ENGLAND. 36 (10): 1439—46. ISSN 0028-3908. PMID 9423932. doi:10.1016/S0028-3908(97)00098-1.

Literatura

Florio P; Severi FM; Ciarmela P; et al. (2003). „Placental stress factors and maternal-fetal adaptive response: the corticotropin-releasing factor family”. Endocrine. 19 (1): 91—102. PMID 12583606. doi:10.1385/ENDO:19:1:91.
Florio P; Rossi M; Sigurdardottir M; et al. (2003). „Paracrine regulation of endometrial function: interaction between progesterone and corticotropin-releasing factor (CRF) and activin A”. Steroids. 68 (10–13): 801—7. PMID 14667971. doi:10.1016/S0039-128X(03)00137-5.
Vamvakopoulos NC; Karl M; Mayol V; et al. (1990). „Structural analysis of the regulatory region of the human corticotropin releasing hormone gene”. FEBS Lett. 267 (1): 1—5. PMID 2365075. doi:10.1016/0014-5793(90)80272-K.
Robinson BG, D'Angio LA, Pasieka KB, Majzoub JA (1989). „Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing”. Mol. Cell. Endocrinol. 61 (2): 175—80. PMID 2783917. doi:10.1016/0303-7207(89)90128-7.
Arbiser JL, Morton CC, Bruns GA, Majzoub JA (1988). „Human corticotropin releasing hormone gene is located on the long arm of chromosome 8”. Cytogenet. Cell Genet. 47 (3): 113—6. PMID 3259914. doi:10.1159/000132525.
Sasaki A; Tempst P; Liotta AS; et al. (1988). „Isolation and characterization of a corticotropin-releasing hormone-like peptide from human placenta”. J. Clin. Endocrinol. Metab. 67 (4): 768—73. PMID 3262120. doi:10.1210/jcem-67-4-768.
Shibahara S; Morimoto Y; Furutani Y; et al. (1984). „Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene”. EMBO J. 2 (5): 775—9. PMC 555184 . PMID 6605851.
Behan DP; Heinrichs SC; Troncoso JC; et al. (1995). „Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer's disease”. Nature. 378 (6554): 284—7. PMID 7477348. doi:10.1038/378284a0.
Kawahito Y; Sano H; Mukai S; et al. (1996). „Corticotropin releasing hormone in colonic mucosa in patients with ulcerative colitis”. Gut. 37 (4): 544—51. PMC 1382908 . PMID 7489943. doi:10.1136/gut.37.4.544.
McLean M; Bisits A; Davies J; et al. (1995). „A placental clock controlling the length of human pregnancy”. Nat. Med. 1 (5): 460—3. PMID 7585095. doi:10.1038/nm0595-460.
Slominski A; Ermak G; Hwang J; et al. (1995). „Proopiomelanocortin, corticotropin releasing hormone and corticotropin releasing hormone receptor genes are expressed in human skin”. FEBS Lett. 374 (1): 113—6. PMID 7589495. doi:10.1016/0014-5793(95)01090-2.
Sutton SW; Behan DP; Lahrichi SL; et al. (1995). „Ligand requirements of the human corticotropin-releasing factor-binding protein”. Endocrinology. 136 (3): 1097—102. PMID 7867564. doi:10.1210/en.136.3.1097.
Vamvakopoulos NC, Chrousos GP (1994). „Structural organization of the 5' flanking region of the human corticotropin releasing hormone gene”. DNA Seq. 4 (3): 197—206. PMID 8161822. doi:10.3109/10425179309015632.
Perrin MH; Donaldson CJ; Chen R; et al. (1994). „Cloning and functional expression of a rat brain corticotropin releasing factor (CRF) receptor”. Endocrinology. 133 (6): 3058—61. PMID 8243338. doi:10.1210/en.133.6.3058.
Romier C, Bernassau JM, Cambillau C, Darbon H (1993). „Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics”. Protein Eng. 6 (2): 149—56. PMID 8386360. doi:10.1093/protein/6.2.149.
Liaw CW; Grigoriadis DE; Lovenberg TW; et al. (1997). „Localization of ligand-binding domains of human corticotropin-releasing factor receptor: a chimeric receptor approach”. Mol. Endocrinol. 11 (7): 980—5. PMID 9178757. doi:10.1210/me.11.7.980.
Timpl P; Spanagel R; Sillaber I; et al. (1998). „Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1”. Nat. Genet. 19 (2): 162—6. PMID 9620773. doi:10.1038/520.
Perone MJ; Murray CA; Brown OA; et al. (1998). „Procorticotrophin-releasing hormone: endoproteolytic processing and differential release of its derived peptides within AtT20 cells”. Mol. Cell. Endocrinol. 142 (1–2): 191—202. PMID 9783915. doi:10.1016/S0303-7207(98)00104-X.
Willenberg HS; Bornstein SR; Hiroi N; et al. (2000). „Effects of a novel corticotropin-releasing-hormone receptor type I antagonist on human adrenal function”. Mol. Psychiatry. 5 (2): 137—41. PMID 10822340. doi:10.1038/sj.mp.4000720.
Saeed B, Fawcett M, Self C (2001). „Corticotropin-releasing hormone binding to the syncytiotrophoblast membranes”. Eur. J. Clin. Invest. 31 (2): 125—30. PMID 11168450. doi:10.1046/j.1365-2362.2001.00770.x.